x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300017124
3300017124: Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, low iron, at 5 C, 35 psu salinity and 560 ?mol photons light - Thalassiosira antarctica CCMP 982 (MMETSP0903)
Overview
Basic Information
IMG/M Taxon OID 3300017124 Open in IMG/M
GOLD Reference (Study | Sequencing Project | Analysis Project) Gs0128947 | Gp0211873 | Ga0186161
Sample Name Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, low iron, at 5 C, 35 psu salinity and 560 ?mol photons light - Thalassiosira antarctica CCMP 982 (MMETSP0903)
Sequencing Status Permanent Draft
Sequencing Center National Center for Genome Resources
Published? N
Use Policy Open
Dataset Contents
Total Genome Size 36268707
Sequencing Scaffolds 1
Novel Protein Genes 1
Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Type Host-Associated
Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Location Information
Location
Coordinates Lat. (o ) N/A Long. (o ) N/A Alt. (m) N/A Depth (m) N/A
Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F099352 Metatranscriptome 103 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0186161_116250 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi 818 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0186161_116250 Ga0186161_1162501 F099352 LSVIVYSHPHIIARHKLTSLSSSKTVSSNSNRVILDSQELNAASGAFNLCCGEAYARFTELKRIKIHPGNMTKERDAVESCSANVYNGIQSSCAEQFDAVKSCVSDNPREWAKCASARRELEVCSVRNNLGELKKA