NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017072

3300017072: Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in 0.2u filtered seawater with ES enrichments, NH4, 15 C, 33 psu salinity and 468 ?mol photons light - Pseudo-nitzschia australis 10249 10 AB (MMETSP0140_2)



Overview

Basic Information
IMG/M Taxon OID3300017072 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212384 | Ga0186672
Sample NameMetatranscriptome of coastal eukaryotic communities from Pacific Ocean in 0.2u filtered seawater with ES enrichments, NH4, 15 C, 33 psu salinity and 468 ?mol photons light - Pseudo-nitzschia australis 10249 10 AB (MMETSP0140_2)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size29232211
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodycoastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)36.60369Long. (o)-121.88927Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081743Metagenome / Metatranscriptome114Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186672_114013All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta638Open in IMG/M
Ga0186672_115099All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta517Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186672_114013Ga0186672_1140131F081743MADPLWLDIDDPKFGPMAEFGRVVRVGFVEDLPLLSFNKRFKGSKHPFYEAVYKKAAKIDKELADNMDTCIAN
Ga0186672_115099Ga0186672_1150991F081743KHLFPGVDGEALFVATVLHSVDHTLMEWNMADPLWLDIDDPKFGPMAEFGRVVRVGFVEDLPLLSFNKRFKGSKHPFYEAVYKKAAKIDKELADNMDTCIAN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.