x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017052
3300017052: Metatranscriptome of marine eukaryotic communities from Ross Sea in PROV medium, 4 C, 32 psu salinity and 522 ?mol photons light - Ochromonas sp. CCMP1899 (MMETSP1177)
Overview
Basic Information |
IMG/M Taxon OID | 3300017052 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0211962 | Ga0186250 |
Sample Name | Metatranscriptome of marine eukaryotic communities from Ross Sea in PROV medium, 4 C, 32 psu salinity and 522 ?mol photons light - Ochromonas sp. CCMP1899 (MMETSP1177) |
Sequencing Status | Permanent Draft |
Sequencing Center | National Center for Genome Resources |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 28787184 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | marine biome → marine water body → sea ice |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information |
Location | Ross Sea |
Coordinates | Lat. (o) | -77.8333 | Long. (o) | 163.0 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F037232 | Metagenome / Metatranscriptome | 168 | Y |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0186250_111442 | Ga0186250_1114421 | F037232 | LDIMVASFGIHETVSTVYGPGYVAEVRKNDYVIKLANWALAQGQSPTLYLAADAIKSIPGAMVGTTVNTVYGPSNVQAIRGDGTHVARPLNWKLANNTVATLYLQSECIKLSQAAGFNEGDEVMTVFGRGFIESKRVKEGDLVIKLHYWALAQGQSPTLYMQSENVVKIHNLQIGSIAKTCWGLVRVLDILRNGQHVCEAVHWVMADGKNPTFYLAPEAFALMSLKP |