x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017035
3300017035: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in seawater with wheat grains, 20 C, 35 psu salinity and 122 ?mol photons light - Paramoeba atlantica 621/1 / CCAP 1560/9 (MMETSP0151_2)
Overview
Basic Information |
IMG/M Taxon OID | 3300017035 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212215 | Ga0186503 |
Sample Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in seawater with wheat grains, 20 C, 35 psu salinity and 122 ?mol photons light - Paramoeba atlantica 621/1 / CCAP 1560/9 (MMETSP0151_2) |
Sequencing Status | Permanent Draft |
Sequencing Center | National Center for Genome Resources |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 25939973 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Location Information |
Location | Atlantic Ocean |
Coordinates | Lat. (o) | 29.60806 | Long. (o) | -28.98667 | Alt. (m) | N/A | Depth (m) | 267.4 |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F004926 | Metagenome / Metatranscriptome | 418 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Ga0186503_105033 | All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica | 1437 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0186503_105033 | Ga0186503_1050331 | F004926 | QIELFQKAKRTLHCVRIKNPGQGKDWTVKNVWSHAKTMVDVFESKGLQPPIIYIHNHDFNGMGAHIGAEVFRLAHAEGFSNLIIDAGYRKNXXXXVLLSVLNLTDEQREALVEWNHNQQEIERILCRFNSRDSQMTPWDSDWAGGTEGSDIRIAKEYALDVRKINTAKEIASEVFPLERAVTPFSEYKLRLGXXXYYD |