NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017035

3300017035: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in seawater with wheat grains, 20 C, 35 psu salinity and 122 ?mol photons light - Paramoeba atlantica 621/1 / CCAP 1560/9 (MMETSP0151_2)



Overview

Basic Information
IMG/M Taxon OID3300017035 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212215 | Ga0186503
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in seawater with wheat grains, 20 C, 35 psu salinity and 122 ?mol photons light - Paramoeba atlantica 621/1 / CCAP 1560/9 (MMETSP0151_2)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25939973
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine benthic featuremarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)29.60806Long. (o)-28.98667Alt. (m)N/ADepth (m)267.4
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004926Metagenome / Metatranscriptome418Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186503_105033All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica1437Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186503_105033Ga0186503_1050331F004926QIELFQKAKRTLHCVRIKNPGQGKDWTVKNVWSHAKTMVDVFESKGLQPPIIYIHNHDFNGMGAHIGAEVFRLAHAEGFSNLIIDAGYRKNXXXXVLLSVLNLTDEQREALVEWNHNQQEIERILCRFNSRDSQMTPWDSDWAGGTEGSDIRIAKEYALDVRKINTAKEIASEVFPLERAVTPFSEYKLRLGXXXYYD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.