x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017030
3300017030: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o nitrate, 20 C and 215 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0707)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300017030 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0211976 | Ga0186264 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o nitrate, 20 C and 215 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0707) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 26692564 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | Pacific Ocean |
| Coordinates | Lat. (o) | 32.655 | Long. (o) | -117.14 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F015298 | Metagenome / Metatranscriptome | 255 | Y |
| F078213 | Metagenome / Metatranscriptome | 116 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186264_110847 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 980 | Open in IMG/M |
| Ga0186264_113557 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis | 705 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0186264_110847 | Ga0186264_1108471 | F078213 | MEFATQLDIDPSLCFGDEGGAVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGFQKLAPKKIADTLRQGGTFVFRGGNTKFQHFDSKVGDNAEIDAILAAI |
| Ga0186264_113557 | Ga0186264_1135571 | F015298 | MNAILEYLIAHKDWLLLVCFSVDAVNTLISFPLIMWKGPKWLLQSTDPDAKEKVEDAKVVVDLTDTDRKSFEVLWEIFGICYEGYFGFTISTLICLFKVPETRPIFAYSLFALYLYKAKAFLRTTIKTDNPQGKGKYMSILFFYWPCYGGYCLLHSIETYFL |
