NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016994

3300016994: Metatranscriptome of marine eukaryotic communities from Arctic Ocean in K/2 medium with silica, 4 C, 35 psu salinity and 494 ?mol photons light - Minutocellus polymorphus RCC 2270 (MMETSP1322)



Overview

Basic Information
IMG/M Taxon OID3300016994 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212300 | Ga0186588
Sample NameMetatranscriptome of marine eukaryotic communities from Arctic Ocean in K/2 medium with silica, 4 C, 35 psu salinity and 494 ?mol photons light - Minutocellus polymorphus RCC 2270 (MMETSP1322)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21526758
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Cymatosirophycidae → Cymatosirales → Cymatosiraceae → Minutocellus → Minutocellus polymorphus1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationArctic Ocean
CoordinatesLat. (o)71.18333333Long. (o)-159.4166667Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051162Metagenome / Metatranscriptome144Y
F067805Metagenome / Metatranscriptome125Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186588_112224All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Cymatosirophycidae → Cymatosirales → Cymatosiraceae → Minutocellus → Minutocellus polymorphus609Open in IMG/M
Ga0186588_112606All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta578Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186588_112224Ga0186588_1122242F067805MGGKGKQKIEDVTLSKKEQKKVTKLEAQIPYHEGRGEKEEADKIQQKIDAIWAKAKEAAFAM
Ga0186588_112606Ga0186588_1126061F051162PLVKLFARTTLTKAIPLPAIQQMMCDVWGTKPETTKLILTRVDDWTEDSFNEDVYVDIRAYGKAERTRDFVLDGMKTIQKNLKDEHELVVNVRLETYDGERYFHVPPPN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.