x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300016990
3300016990: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 23 C, 34 psu salinity and 120 ?mol photons light - Cyclophora tenuis ECT3854 (MMETSP0397)
Overview
Basic Information
IMG/M Taxon OID 3300016990 Open in IMG/M GOLD Reference Gs0128947 | Gp0212079 | Ga0186367 Sample Name Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 23 C, 34 psu salinity and 120 ?mol photons light - Cyclophora tenuis ECT3854 (MMETSP0397) Sequencing Status Permanent Draft Sequencing Center National Center for Genome Resources Published? N Use Policy Open
Dataset Contents
Total Genome Size 17159905 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Fragilariophyceae → Fragilariophycidae → Cyclophorales → Cyclophoraceae → Cyclophora → Cyclophora tenuis 2
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Alternative Ecosystem Assignments
Environment Ontology (ENVO) marine biome → rocky reef → sea water Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
Location Information
Location North Pacific Ocean Coordinates Lat. (o ) 21.514 Long. (o ) -157.8362 Alt. (m) N/A Depth (m) 1 Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F051162 Metagenome / Metatranscriptome 144 Y F067805 Metagenome / Metatranscriptome 125 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0186367_106444 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Fragilariophyceae → Fragilariophycidae → Cyclophorales → Cyclophoraceae → Cyclophora → Cyclophora tenuis 1028 Open in IMG/M Ga0186367_111177 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Fragilariophyceae → Fragilariophycidae → Cyclophorales → Cyclophoraceae → Cyclophora → Cyclophora tenuis 619 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0186367_106444 Ga0186367_1064441 F051162 SHPTSIKHPTMPLVKIFAKQTMTKPIPLAALQSKLCDIWGTKPNTTKLMLQRVDDWTDESFQEDCYVDIRAKGTEERTREYVLDGMKRVQGAFKEHDLSANVRLATYEGPRYFHVPPSTN Ga0186367_111177 Ga0186367_1111771 F067805 MGGKKNKQSMEEVSLSKKDAKKVAKLEAQIPYHTGRGNMEEVEKIKGQIDAIWQKTREAAFAM
