Sample 3300016973

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300016973

3300016973: Metatranscriptome of coastal eukaryotic communities from Atlantic Ocean in F/2 medium with seawater with 10uM nitrate, 14 C, 35 psu salinity and 469 ?mol photons light - Thalassiosira gravida GMp14c1 (MMETSP0493)

Overview

Basic Information
IMG/M Taxon OID	3300016973 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0128947 \| Gp0212413 \| Ga0186701
Sample Name	Metatranscriptome of coastal eukaryotic communities from Atlantic Ocean in F/2 medium with seawater with 10uM nitrate, 14 C, 35 psu salinity and 469 ?mol photons light - Thalassiosira gravida GMp14c1 (MMETSP0493)
Sequencing Status	Permanent Draft
Sequencing Center	National Center for Genome Resources
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	25801018
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → coastal water body → coastal sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Atlantic Ocean
Coordinates	Lat. (^o)	41.92732	Long. (^o)	-67.85788	Alt. (m)	N/A	Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067805	Metagenome / Metatranscriptome	125	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0186701_110754	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	953	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186701_110754	Ga0186701_1107541	F067805	QPKEEELALSKKEQKKVDKLTAQIPYHQGRGNMEEVTKIKGQIDSIWEKAKEAQFA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.