NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016958

3300016958: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 142 ?mol photons light - Emiliania huxleyi 374 (MMETSP1006)



Overview

Basic Information
IMG/M Taxon OID3300016958 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212259 | Ga0186547
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 142 ?mol photons light - Emiliania huxleyi 374 (MMETSP1006)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17188796
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)42.5Long. (o)-69.0Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009840Metagenome / Metatranscriptome312Y
F034449Metagenome / Metatranscriptome174N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186547_108838All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi723Open in IMG/M
Ga0186547_109598All Organisms → cellular organisms → Eukaryota669Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186547_108838Ga0186547_1088381F034449ENTYMPTLKLAALALLASSTAALKVEKPVVKPVLKLRGGVSAGDVITGGALFLSASVGLPALAGGSDALFMINYPGFDWAGYQAKWTAESKSYLDTMTRFFGGALLLAGALQYYAKDVMAAKPYYAILTVTQLVFAGLQIFFAAPTAAMPSVHYVYAGMNAVLAVAGAMAMI
Ga0186547_109598Ga0186547_1095981F009840FRGTSALQPSRPGVSRRPLLQHALALGVLAPGAAAAAAEKKPSLKEVVAQLDAGTPKEERNAHGEKADHFPQIAFEGGQGQGKKVVFTVPHQNLSPPSFSYIEYMWIKDEESGAILTARKFRPSDPDLVITAFGSSGQRLTAASKDDKFGIWQGTFRVP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.