NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016950

3300016950: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium with nocodazole, 20 C and 207 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0708)



Overview

Basic Information
IMG/M Taxon OID3300016950 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0211978 | Ga0186266
Sample NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium with nocodazole, 20 C and 207 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0708)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12414144
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)32.655Long. (o)-117.14Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015298Metagenome / Metatranscriptome255Y
F051162Metagenome / Metatranscriptome144Y
F064367Metagenome / Metatranscriptome128Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186266_106646All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta701Open in IMG/M
Ga0186266_107159All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta670Open in IMG/M
Ga0186266_107621All Organisms → cellular organisms → Eukaryota643Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186266_106646Ga0186266_1066461F015298MNAILEYLIAHKDWLLLVCFSVDAVNTLISFPLIMWKGPKWLLQSTDPDAKEKVEDAKVVVDLTDTDRKSFEVLWEIFGICYEGYFGFTISTLICLFKVPETRPIFAYSLFALYLYKAKAFLRTTIKTDNPQGKGKFMSILFFYWPCYGGYCLLHSIETYFL
Ga0186266_107159Ga0186266_1071591F051162MPLVKIFARTTMAKPIPLAAIQSKLCDIWGTKPNTTKLMLSRVEDWTDESFQEDCYVDIRAYGKPERTREMVLDGMQKVQGAFKEHDLIANGKFDL
Ga0186266_107621Ga0186266_1076211F064367ERGGRHPERLAQDRDCCLRDVPEGAQCRPDGFDAPGTKAIDRDDDYSDGCEYSHFIFGTDEAALGSDMGLVYKFDVDTRGFPSGCPGLATFYPSGNRFSDYTCGIDGRPWFADPSLSWNDIELERVTKNEWTDRGCPVDCPRQDYKYPGDSLSLADHVERYADDQDAWIQEFIPVMEKMIANGYTENDLVVSFNGSMP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.