NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016928

3300016928: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 14nM iron, 19 C, 35 psu salinity and 610 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1415)



Overview

Basic Information
IMG/M Taxon OID3300016928 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212285 | Ga0186573
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 14nM iron, 19 C, 35 psu salinity and 610 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1415)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size29324371
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)37.0Long. (o)-65.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051162Metagenome / Metatranscriptome144Y
F099352Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186573_112577All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi863Open in IMG/M
Ga0186573_114067All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta709Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186573_112577Ga0186573_1125771F099352MVDFTQQAFNGDSLSLEREVSVTSNNNRVILDSKELNASSGPFNLCCGEAYARFSELKRQKVHPAKMTKERDAVESCSADVYKGMQSNCVTQFEAVISCLSDNPKEWAKCAVLRRELDVCAVKNKLGEIAKLG
Ga0186573_114067Ga0186573_1140671F051162VNYDRLTMPLVKIFARNGMTKSIPLTTLQSKLCGIWGTKPETTKLMLSRVDDWTSDHKEDCYVDIRAYGKPERTRDFVLDGMAKVQQAFAEHDLAANVRLETYEGERYFHVPPKNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.