NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016919

3300016919: Metatranscriptome of marine eukaryotic communities from Great Salt Lake in f/2 medium with seawater, 29 C, 35 psu salinity and 209 ?mol photons light - Chaetoceros sp. GSL56 (MMETSP0200_2)



Overview

Basic Information
IMG/M Taxon OID3300016919 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0212160 | Ga0186448
Sample NameMetatranscriptome of marine eukaryotic communities from Great Salt Lake in f/2 medium with seawater, 29 C, 35 psu salinity and 209 ?mol photons light - Chaetoceros sp. GSL56 (MMETSP0200_2)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25096967
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationGreat Salt Lake
CoordinatesLat. (o)40.95118Long. (o)-112.08824Alt. (m)N/ADepth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051162Metagenome / Metatranscriptome144Y
F067805Metagenome / Metatranscriptome125Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186448_100220All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta6759Open in IMG/M
Ga0186448_109660All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi832Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186448_100220Ga0186448_1002203F051162MPLVKLFARKTLSKPINLSSLQQKLCSIWNTKPDTTKLILTRVDDWTDDSFKEDIYVDIRAYGKKERTRDMVFEGMKQVQHAFGEEGLVANVRLEVYDGEKYFHLPPPSNPQP
Ga0186448_109660Ga0186448_1096601F067805MGGNKNKQKEEEVTLNKKDQKKVDKLTAMIPYHEGRGNKEEVEKIKQQIDDIWQKAKEALWA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.