NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016906

3300016906: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in ESM medium with SW802, 23 C, 35 psu salinity and 431 ?mol photons light - Goniomonas sp. m (MMETSP0114)



Overview

Basic Information
IMG/M Taxon OID3300016906 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0212291 | Ga0186579
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in ESM medium with SW802, 23 C, 35 psu salinity and 431 ?mol photons light - Goniomonas sp. m (MMETSP0114)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size24601976
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Cryptophyceae2
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP27121

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → beach → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)46.5105Long. (o)-63.4856Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005668Metagenome / Metatranscriptome393Y
F026478Metagenome / Metatranscriptome197Y
F086665Metagenome / Metatranscriptome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186579_111650All Organisms → cellular organisms → Eukaryota → Cryptophyceae672Open in IMG/M
Ga0186579_113841All Organisms → cellular organisms → Eukaryota → Cryptophyceae522Open in IMG/M
Ga0186579_114191All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712504Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186579_111650Ga0186579_1116501F026478EGNLDNMRAVVLVFAFALLLAVSAQKPKRKPVSADDEDVQKAVKFALAEIVKLSDSYRDMRINKVQSAETARSAFADGTNYFLKMELECVSKCAAPLSPASTCRRGKYKGTNEIIVFEKDDGHYDGIAIDEFPQMDGEYHPCTPSYKGAEKCNPAEHRTPEQAALFLDDPEDEVKGKDEL
Ga0186579_113841Ga0186579_1138411F086665RAYVAAGNNMVFMGGYLSLQVMNDIFGFSLRDDFKEGPYYRNDRNVRDTPFQFLPSRINEPSPRVFGAMSRSLPPGGRSLYDSLGCSVVFYISYDLGTIVYVGFQYDTPFTIDRWVRVLHAAIDM
Ga0186579_114191Ga0186579_1141911F005668MFSLLFDLEDYAGTYRETRNAYLKAANELKLATGPYKAARDAYVAATATYTKSLYE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.