NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016887

3300016887: Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 21 C, 35 psu salinity and 419 ?mol photons light - micromonas sp. RCC451 (MMETSP1400)



Overview

Basic Information
IMG/M Taxon OID3300016887 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212081 | Ga0186369
Sample NameMetatranscriptome of marine eukaryotic communities from North Atlantic Ocean in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 21 C, 35 psu salinity and 419 ?mol photons light - micromonas sp. RCC451 (MMETSP1400)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20063319
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas1
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Atlantic Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062730Metagenome / Metatranscriptome130N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186369_100816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas3863Open in IMG/M
Ga0186369_101277All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon3252Open in IMG/M
Ga0186369_102034All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon2617Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186369_100816Ga0186369_1008162F062730MCDTYNMGTETPVGYRLVRVGVRGRVPTLHTRAPEDLTTRQKYDLRYREKHRAKLLAYHREYYRKKRKLY
Ga0186369_101277Ga0186369_1012771F062730MGTETPVGYRLVRVGVRGRVPTLHTRAPEDLTTRQKYDLRYREKHRAKLLAYHREYYRKGKCQTR
Ga0186369_102034Ga0186369_1020341F062730MCDTYNMGTETPVGYRLVRVGVRGRVPTLHTRATEDLTSQQKYDLRYREKLLAYHREYYR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.