NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016879

3300016879: Metatranscriptome of marine eukaryotic communities from Indian Ocean in L1 medium with seawater, 20 C, 33 psu salinity and 550 ?mol photons light - unclassified eukaryote RCC 701 (MMETSP1453)



Overview

Basic Information
IMG/M Taxon OID3300016879 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212127 | Ga0186415
Sample NameMetatranscriptome of marine eukaryotic communities from Indian Ocean in L1 medium with seawater, 20 C, 33 psu salinity and 550 ?mol photons light - unclassified eukaryote RCC 701 (MMETSP1453)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12749222
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationIndian Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)70
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037232Metagenome / Metatranscriptome168Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186415_106029All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii841Open in IMG/M
Ga0186415_106099All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii829Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186415_106029Ga0186415_1060291F037232MSAFKIYDLVNTVYGTGYVAAIRSDCYVVLLTHWKLAQGQSPTLYLQAEAMTLIPGALPGTVVKTPFGPAQLQSVRADNMHIAKPINWKLANNTIATMYLQPEVVQLTQTPGFNEGDEVMTVYGQGFVQSKREKEGDLVVLLRNWALAQGQSPTCYLHPSACVKIPGLQIGAAMKTVWGLMRLLSIRRDGTHVCEAMHWNLADGKPPRCYLAPEAFALVSIKP
Ga0186415_106099Ga0186415_1060991F037232RQASFVIMSAFKIYDLVNTVYGTGYVAAIRSDCYVVLLTHWKLAQGQSPTLYLQAEAMTLIPGALPGTVVKTPFGPAQLQSVRADNMHIAKPINWKLANNTIATMYLQPEVVQLTQTPGFNEGDEVMTVYGQGFVQSKREKEGDLXXXXLAQGQSPTCYLHPSACVKIPGLQIGAAMKTVWGLMRLLSIRRDGTHVCEAMHWNLADGKPPRCYLAPEAFALVSIKP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.