NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016876

3300016876: Metatranscriptome of marine eukaryotic communities from North Sea in K medium, 15 C, 35 psu salinity and 506 ?mol photons light - Bolidomonas sp. RCC1657 (MMETSP1321)



Overview

Basic Information
IMG/M Taxon OID3300016876 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212060 | Ga0186348
Sample NameMetatranscriptome of marine eukaryotic communities from North Sea in K medium, 15 C, 35 psu salinity and 506 ?mol photons light - Bolidomonas sp. RCC1657 (MMETSP1321)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23036372
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Sea
CoordinatesLat. (o)49.31666667Long. (o)-3.31666667Alt. (m)N/ADepth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015298Metagenome / Metatranscriptome255Y
F026197Metagenome / Metatranscriptome198Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186348_107054All Organisms → cellular organisms → Eukaryota1080Open in IMG/M
Ga0186348_107306All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1050Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186348_107054Ga0186348_1070541F026197TNGPHSMPKLLLLLLIGRSVAMSIPAHITEETLCANGTCEDPDLPYSRVAASQPGYQWNDAGGYCGSWATQRAVLSQGAWISQQQVRDHTSPCGGNDNEILSCNIEEAWTNLKLDYDGFDYDTSPLPQTEAYKTWLKSHLVQGHAVAWMILWSGQEYPIYDLTPPAGMYGHVEPVIGIQSNHPLNETTVYDDDVVLHYTDGGINTVHRTLSSLPGEWGGEGEKADCGDYSYCIGNPYGFGWAVKGFADGGVTSSPASLKVDPWMSEPDTRSGEAPEDLKGTLTATDLEEGATYDIYRWDSVKEAFTFDDEYKKTTFTATSDTFVYEDDKSFSSDGTTYYRVVQQQN
Ga0186348_107306Ga0186348_1073061F015298MINGMLGYMIAHKDWLLLGCFSVDAINTMISFPLIMWNGPKWVLKSTEPDAKEKIEDAQEAKKVVDLSDTERKSFEVLWEIFGICYEGYFGFTISTLICLFQVPETRPIFAYSLFALYLYKAKAFFTTFKTDNKQGKTKLMTILYFYWPCYGGYCLLHLIEKYLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.