NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016853

3300016853: Metatranscriptome of marine eukaryotic communities from Saldanha Bay in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 21 C, 35 psu salinity and 627 ?mol photons light - Micromonas pusilla CCAC 1681 (MMETSP1401)



Overview

Basic Information
IMG/M Taxon OID3300016853 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211960 | Ga0186248
Sample NameMetatranscriptome of marine eukaryotic communities from Saldanha Bay in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 21 C, 35 psu salinity and 627 ?mol photons light - Micromonas pusilla CCAC 1681 (MMETSP1401)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size16858591
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSaldanha Bay
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021976Metagenome / Metatranscriptome216Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186248_102821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas1956Open in IMG/M
Ga0186248_103207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla1805Open in IMG/M
Ga0186248_104809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla1351Open in IMG/M
Ga0186248_107584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla810Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186248_102821Ga0186248_1028212F021976MVAKASGSAKRRARKLKRDVAAQAGVAFPGLPFDVAVSLVEKHLPDPADLAVLRAVSKGMRDAVDA
Ga0186248_103207Ga0186248_1032072F021976VTTRAVRASPAAMVAKASGSAKRRARKLKRDVAAQAGVAFPGLPFDVAVSLVEKHLPDPADLAVLRAVSKGMRDAVDA
Ga0186248_104809Ga0186248_1048091F021976MRTVRAASALMVAEASRGVETRARKRKRDLDSQAGVAIPGLPFDVAVSLVEKHLPDPADLAVLR
Ga0186248_107584Ga0186248_1075842F021976MRTVRAASALMVAEASRGVETRARKRKRDLDSQAGVAIPGLPFDVAVSLVEKHLPDPADLAVLRAVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.