NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016848

3300016848: Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 765 ?mol photons light - Chaetoceros neogracile CCMP 1317 (MMETSP0751)



Overview

Basic Information
IMG/M Taxon OID3300016848 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0211777 | Ga0186065
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 765 ?mol photons light - Chaetoceros neogracile CCMP 1317 (MMETSP0751)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size29193536
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1
All Organisms → cellular organisms → Eukaryota → Sar1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051162Metagenome / Metatranscriptome144Y
F067805Metagenome / Metatranscriptome125Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186065_114358All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta597Open in IMG/M
Ga0186065_115061All Organisms → cellular organisms → Eukaryota → Sar507Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186065_114358Ga0186065_1143581F051162MPLVKIFARQALTKQVPLTKLQSKLCSIWNTKPNTTKLILFRVEDWTNESYHEDVYVDIRAYGKAERTREMVLVGMQDVQKAFQEHDLVANVRLETYDGEKYFHVPPGGGN
Ga0186065_115061Ga0186065_1150611F067805MGGRKNVVVEEEIKLNKKDQKKVDKLLAQIPYHDGRGNKEEVDKIRQQVDEIWRKTREAALM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.