NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016843

3300016843: Metatranscriptome of marine eukaryotic communities from English Channel in L1 medium with seawater, 14 C, 33 psu salinity and 551 ?mol photons light - unclassified eukaryote RCC 1871 (MMETSP1456)



Overview

Basic Information
IMG/M Taxon OID3300016843 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212166 | Ga0186454
Sample NameMetatranscriptome of marine eukaryotic communities from English Channel in L1 medium with seawater, 14 C, 33 psu salinity and 551 ?mol photons light - unclassified eukaryote RCC 1871 (MMETSP1456)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12008672
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEnglish Channel
CoordinatesLat. (o)48.75Long. (o)-3.95Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079415Metagenome / Metatranscriptome115N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186454_104566All Organisms → cellular organisms → Eukaryota1036Open in IMG/M
Ga0186454_104959All Organisms → cellular organisms → Eukaryota955Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186454_104566Ga0186454_1045661F079415MTTNNKQCGWVGMDDPRYENDREVKIDQIGCPQCGTVWGGWYQENEAGTGGSVRYPPNAIIGPGINGAGYFQFFPRYLSLGCRGKKVEVQAVYKLIDAGEEQIGSGPYYAGLSLTDTPWYPKNLTRCSIGTGQEPSNTLSNCRECQQSASGEGGCPIEKDTWYMDTMILDMPEQCPPSQDGPVMPSIFVNPYQTLNVSAFTATPIT
Ga0186454_104959Ga0186454_1049591F079415MKSTALAVALAVALAVATVSTCLAEKEESYLEAATHFCETMTTNNKQCGWVGMDDPRYENDREVKIDQIGCPQCGTVWGGWYQENEAGTGGSVRYPPNAIIGPGINGAGYFQFFPRYLSLGCRGKKVEVQAVYKLIDAGEEQIGSGPYYAGLSLTDTPWYPKNLTRCSIGTGQEPSNTLSNCRECQQSASGEGGCPIEKDTWYMDTMILDMPEQCPPSQDGPVMPSIFVNPYQTLNVSAFTATPIT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.