NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016837

3300016837: Metatranscriptome of marine eukaryotic communities from Sargasso Sea in f/2 medium with seawater, no silicate, 21 C, 35 psu salinity and 452 ?mol photons light - Pycnococcus sp. CCMP1998 (MMETSP1085)



Overview

Basic Information
IMG/M Taxon OID3300016837 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211952 | Ga0186240
Sample NameMetatranscriptome of marine eukaryotic communities from Sargasso Sea in f/2 medium with seawater, no silicate, 21 C, 35 psu salinity and 452 ?mol photons light - Pycnococcus sp. CCMP1998 (MMETSP1085)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12858434
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSargasso Sea
CoordinatesLat. (o)20.7722Long. (o)-63.0368Alt. (m)N/ADepth (m)125
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079415Metagenome / Metatranscriptome115N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186240_105166All Organisms → cellular organisms → Eukaryota940Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186240_105166Ga0186240_1051661F079415VTRARIKRNETGSGATQTRASRRPRTRPSAPPRHKARPPTKRKMKSTALAVALAVALAVATVSTCLAEKEESYFEAAYRFEATHFCETMTTNNKQCGWVGMDDPRYENDREVKINQIGCPMCGTEWGGWYEANEAGTGVSLRYPPNAIIGPGIRGAGYSQYFPRFLSLGCRGKKVEVQAVYKLIDAGEEQNGSGPYYAGLSLTDTPWYPKNLTRCSIGTGQEPSNTAADCRECQQSASGEGGCPIEKDTWYMDTVILDMPEQCPPSQDGPVMPSILVNAYQTLNVSAFTATPIT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.