| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300016796 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212049 | Ga0186337 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean grown at 7 C, 34.25 psu salinity and 124 ?mol photons light - unclassified eukaryote Undescribed (MMETSP1317) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 11390682 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine benthic feature → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 120.06 | Long. (o) | -34.175 | Alt. (m) | N/A | Depth (m) | 570 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092248 | Metagenome / Metatranscriptome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0186337_105748 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 589 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0186337_105748 | Ga0186337_1057481 | F092248 | LLRLLLPLSDKVYLISRLGSRSSPKGSPDHSKSVGATGGVYKGQGL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |