NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016789

3300016789: Metatranscriptome of marine eukaryotic communities from unknown location in L1 mediium with seawater, at 24 C, 33 psu salinity and 564 ?mol photons light - unclassified eukaryote CCMP 1205 (MMETSP1469)



Overview

Basic Information
IMG/M Taxon OID3300016789 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211814 | Ga0186102
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in L1 mediium with seawater, at 24 C, 33 psu salinity and 564 ?mol photons light - unclassified eukaryote CCMP 1205 (MMETSP1469)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size14592574
Sequencing Scaffolds0
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056539Metagenome / Metatranscriptome137Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186102_107118Ga0186102_1071181F056539SCVVCSVMKTQLILLFACLISLAAAQLALVNPVGRGFSFGDARHGPCGQSPTEVGNRIAWEQDTVHEIEVQIFGAAGGGVIVDRYSCVLNGDDENPIEPILPIEGALKVEVPDVDDQIYRLYVRTPSFRCTGDVTMQLVYATENGHEFFQCQDIVLTYSGASSLTMSVLAVIAVVLMVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.