NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016782

3300016782: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in K medium, 20 C, 35 psu salinity and 430 ?mol photons light - unclassified eukaryote RCC 998 (MMETSP1309)



Overview

Basic Information
IMG/M Taxon OID3300016782 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211998 | Ga0186286
Sample NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in K medium, 20 C, 35 psu salinity and 430 ?mol photons light - unclassified eukaryote RCC 998 (MMETSP1309)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13984299
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)-9.06666667Long. (o)-136.9833333Alt. (m)N/ADepth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079415Metagenome / Metatranscriptome115N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186286_105212All Organisms → cellular organisms → Eukaryota1028Open in IMG/M
Ga0186286_105446All Organisms → cellular organisms → Eukaryota977Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186286_105212Ga0186286_1052122F079415MLTRCSFACPHAETMTPEEDHCGWVGVEAKEDASGVYDPRYQKDREVAINEINCPQCGTVWGGWYEENEAGTGGSVKYPPNAIIGPGINGAGYFQFFPRYLSLGCRGKKVEVQAVYKLIDAGEEQNGSGPYDAGLEIGDGQNMTKCSRGSGSEPGEIDVNCRVCSNGNQACLIEKDTWYEDTMILDIPEQCPPGDRPGGVMFSIFVNPYQTLNVSAFTATPIG
Ga0186286_105446Ga0186286_1054461F079415MTNNNKQCGWVGVEDPRYQNDREVKIDQIGCPDCGTVWGGWYEENEAGTGGSVKYPPNAIIGPGINGAGYFQFFPRYLSLGCRGKKVEVQAVYKLIDAGEEQNGSGPYYAGLSLDGDFWSPQNLTRCSLGSGPVGNTLSDCRECQQNASGEGDCPIEKDTWYQDTMILDMPEQCPPSPDGPVMPSIFVNPYQTLNVSAFTATPI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.