NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016716

3300016716: Metatranscriptome of marine eukaryotic communities from Gulf of Thailand in Prov 50 medium, 20 C, 21 psu salinity and 208 ?mol photons light - Bolidomonas pacifica CCMP 1866 (MMETSP0785)



Overview

Basic Information
IMG/M Taxon OID3300016716 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212134 | Ga0186422
Sample NameMetatranscriptome of marine eukaryotic communities from Gulf of Thailand in Prov 50 medium, 20 C, 21 psu salinity and 208 ?mol photons light - Bolidomonas pacifica CCMP 1866 (MMETSP0785)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23983672
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationGulf of Thailand
CoordinatesLat. (o)5.5Long. (o)105.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026197Metagenome / Metatranscriptome198Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186422_107018All Organisms → cellular organisms → Eukaryota1139Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186422_107018Ga0186422_1070181F026197EGFPFLRKSQQKLPPNRAPFNTAVTLTYIFTMFRSTLSLLLLPAVSALLKMPSGITEETLCDGGLCDDRDLPYSNLIPSQPGYQWNDAGGYCGSWATQRAVLSKGAWISQQQVRDHTSPCGGNDNEILSCNIDEAWTNLKLDYDGFDFKSLETPQTDGYKSWLKAQLAQGNAVAWMILWSGQTYPIYDLTPPSGMYGHVEPVIGIQSNHPLNDTTVYDDDVILHYTDGGVNTVHREMSTLSGEWGGPGEKADCGDYSYCIGNPWGFGWAVKGFADDVVAAPASLHISPWMKEPDTRSGEDPDEIQGTLTATDLEEGATYAIYRWDSVKEALTYSDEYKKTTFKATSDTYEYVDDKSFQSDSATYYRVVKQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.