NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016706

3300016706: Metatranscriptome of marine eukaryotic communities from Gulf of Naples in f/2 medium with Monterey Bay seawater w/o silicate, 21 C, 35 psu salinity and 305 ?mol photons light - micromonas sp. CCMP1646 (MMETSP1080)



Overview

Basic Information
IMG/M Taxon OID3300016706 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212135 | Ga0186423
Sample NameMetatranscriptome of marine eukaryotic communities from Gulf of Naples in f/2 medium with Monterey Bay seawater w/o silicate, 21 C, 35 psu salinity and 305 ?mol photons light - micromonas sp. CCMP1646 (MMETSP1080)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17732743
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationGulf of Naples
CoordinatesLat. (o)40.75Long. (o)14.33Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021976Metagenome / Metatranscriptome216Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186423_108060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla674Open in IMG/M
Ga0186423_108095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla668Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186423_108060Ga0186423_1080601F021976VHAASAAMVAEAARGVETRARKSKRELDAQAGVAFPGLPFDVAVSLVEKHLPDPADLAVL
Ga0186423_108095Ga0186423_1080951F021976VHAASAAMVAEAARGVETRARKSKRELDAQAGVAFPGLPFDVAVSLVEKHLPDPADLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.