x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300016706
3300016706: Metatranscriptome of marine eukaryotic communities from Gulf of Naples in f/2 medium with Monterey Bay seawater w/o silicate, 21 C, 35 psu salinity and 305 ?mol photons light - micromonas sp. CCMP1646 (MMETSP1080)
Overview
Basic Information
IMG/M Taxon OID 3300016706 Open in IMG/M GOLD Reference Gs0128947 | Gp0212135 | Ga0186423 Sample Name Metatranscriptome of marine eukaryotic communities from Gulf of Naples in f/2 medium with Monterey Bay seawater w/o silicate, 21 C, 35 psu salinity and 305 ?mol photons light - micromonas sp. CCMP1646 (MMETSP1080) Sequencing Status Permanent Draft Sequencing Center National Center for Genome Resources Published? N Use Policy Open
Dataset Contents
Total Genome Size 17732743 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla 2
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Location Information
Location Gulf of Naples Coordinates Lat. (o ) 40.75 Long. (o ) 14.33 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F021976 Metagenome / Metatranscriptome 216 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0186423_108060 All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla 674 Open in IMG/M Ga0186423_108095 All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas pusilla 668 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0186423_108060 Ga0186423_1080601 F021976 VHAASAAMVAEAARGVETRARKSKRELDAQAGVAFPGLPFDVAVSLVEKHLPDPADLAVL Ga0186423_108095 Ga0186423_1080951 F021976 VHAASAAMVAEAARGVETRARKSKRELDAQAGVAFPGLPFDVAVSLVEKHLPDPADLA
