Sample 3300014779

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014779

3300014779: Synthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg4

Overview

Basic Information
IMG/M Taxon OID	3300014779 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0127414 \| Gp0192469 \| Ga0169465
Sample Name	Synthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg4
Sequencing Status	Permanent Draft
Sequencing Center	University of Liverpool
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	95897884
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom
Type	Engineered
Taxonomy	Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Synthetic → Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	na → na → na

Location Information
Location	United Kingdom: Liverpool
Coordinates	Lat. (^o)	53.405936	Long. (^o)	-2.9677609	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010244	Metagenome / Metatranscriptome	306	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0169465_1024976	All Organisms → cellular organisms → Bacteria	944	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0169465_1024976	Ga0169465_10249762	F010244	MFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.