NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014717

3300014717: Human bile duct microbial communities from gallstone patients in Hangzhou, China - C4_bile



Overview

Basic Information
IMG/M Taxon OID3300014717 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121295 | Gp0151506 | Ga0134334
Sample NameHuman bile duct microbial communities from gallstone patients in Hangzhou, China - C4_bile
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Institution of Radiation Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3888001
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China
TypeHost-Associated
TaxonomyHost-Associated → Human → Excretory System → Liver → Bile → Human Bile Duct → Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal proximal gut

Location Information
LocationChina: Hangzhou
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077438Metagenome / Metatranscriptome117Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0134334_12218All Organisms → cellular organisms → Bacteria621Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0134334_12218Ga0134334_122181F077438THRDELSFRQSRFETLFSWNLQVEISLALRTMVEKEISSYKN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.