Basic Information | |
---|---|
IMG/M Taxon OID | 3300014587 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121326 | Gp0152454 | Ga0135122 |
Sample Name | Indoor hospital air microbial communities from San Diego, USA - 248_D2_2014-9-5 |
Sequencing Status | Permanent Draft |
Sequencing Center | San Diego State University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 9107078 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Indoor Hospital Air Microbial Communities From San Diego, Usa |
Type | Environmental |
Taxonomy | Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: San Diego, California | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063475 | Metagenome / Metatranscriptome | 129 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0135122_104726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0135122_104726 | Ga0135122_1047262 | F063475 | VDNGGFIAAFLHHVFNQATLYGVIVGDQNGGSHGTPRTLQLSVPNRGTVADAD* |
⦗Top⦘ |