NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014574

3300014574: Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_S1_MetaG



Overview

Basic Information
IMG/M Taxon OID3300014574 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127568 | Gp0198141 | Ga0180011
Sample NameGroundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_S1_MetaG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size36233086
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGroundwater Microbial Communities From Three Deep Subsurface Sites In Europe
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomeplanetary subsurface zonegroundwater
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationFinland: the Olkiluoto Island
CoordinatesLat. (o)61.2413Long. (o)21.4947Alt. (m)N/ADepth (m)420
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065251Metagenome / Metatranscriptome128Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0180011_101616All Organisms → cellular organisms → Archaea1514Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0180011_101616Ga0180011_1016161F065251MHLRSFKRGKKRYYFIAKSVRNGKKVIQKSILYLGTADTIYKKLLKVKNSKN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.