Sample 3300014506

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014506

3300014506: Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0160 : 32 days incubation

Overview

Basic Information
IMG/M Taxon OID	3300014506 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121288 \| Gp0151325 \| Ga0134302
Sample Name	Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0160 : 32 days incubation
Sequencing Status	Permanent Draft
Sequencing Center	Battelle Memorial Institute, Gulf Coast Restoration Organization
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	9629986
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → coastal water body → coastal sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Norway: Trondheimsfjord
Coordinates	Lat. (^o)	63.43	Long. (^o)	10.43	Alt. (m)	N/A	Depth (m)	90
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047315	Metagenome / Metatranscriptome	150	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0134302_100005	All Organisms → cellular organisms → Bacteria	10684	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134302_100005	Ga0134302_1000054	F047315	MSTMTDYDAGRLVTQIENLSKQVESLNTTTVTLSKRINELEKQLVKGKGFLAGAMLLSMGLGGVGTSFLAKWLGT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.