| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014504 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121300 | Gp0151681 | Ga0134509 |
| Sample Name | Deep-sea hydrothermal vent sediment bacterial and viral communities from Southwest Indian Ocean - SWIR-S021-M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Zhejiang University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3907367 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Collierbacteria → Candidatus Collierbacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep-Sea Hydrothermal Vent Sediment Bacterial And Viral Communities From Southwest Indian Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep-Sea Hydrothermal Vent Sediment → Deep-Sea Hydrothermal Vent Sediment Bacterial And Viral Communities From Southwest Indian Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → deep marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Indian Ocean | |||||||
| Coordinates | Lat. (o) | -37.88 | Long. (o) | 49.66 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033389 | Metagenome / Metatranscriptome | 177 | Y |
| F091297 | Metagenome | 107 | Y |
| F091388 | Metagenome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134509_10002 | Not Available | 19434 | Open in IMG/M |
| Ga0134509_10015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Collierbacteria → Candidatus Collierbacteria bacterium | 7617 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134509_10002 | Ga0134509_1000212 | F091297 | MELRKINSKKGIQLSQAFGAVLTLVLVAVLVIIAIFLFVTLSDSFTADSAEANASDAMVTEFSNYTSLIGLVGTIIFLGLVIGVLVTSFAFGGRRV* |
| Ga0134509_10002 | Ga0134509_1000217 | F033389 | MVAKSARTKRTAMMRAAEERKKGLSASIFKKKKGYGVSVTRKK* |
| Ga0134509_10015 | Ga0134509_100154 | F091388 | MENRNEMRLKQKAKFYYNERLECHIVKEPKGFINGFFKSDLIDGLYYLFEDQRFPDEQKKLFLWDIFDISDYEVEVK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |