NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014123

3300014123: Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - In3P-11 SPAdes reassembly



Overview

Basic Information
IMG/M Taxon OID3300014123 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095512 | Gp0123721 | Ga0181474
Sample NameClean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - In3P-11 SPAdes reassembly
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12523442
Sequencing Scaffolds11
Novel Protein Genes13
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca2
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → unclassified Corallococcus → Corallococcus sp. AB038B2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli1
Not Available1
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameClean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa
TypeEngineered
TaxonomyEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Surface (non-saline)

Location Information
LocationUSA: Jet Propulsion Laboratory, Pasadena, California
CoordinatesLat. (o)34.1Long. (o)-118.1Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017428Metagenome240Y
F021064Metagenome / Metatranscriptome220Y
F023843Metagenome / Metatranscriptome208Y
F028713Metagenome / Metatranscriptome190Y
F034461Metagenome / Metatranscriptome174Y
F046363Metagenome / Metatranscriptome151Y
F065416Metagenome / Metatranscriptome127Y
F078089Metagenome116Y
F096629Metagenome / Metatranscriptome104Y
F100750Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0181474_100325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea6244Open in IMG/M
Ga0181474_100376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca5843Open in IMG/M
Ga0181474_100388All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis5767Open in IMG/M
Ga0181474_100714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus4259Open in IMG/M
Ga0181474_100892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca3655Open in IMG/M
Ga0181474_101015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3287Open in IMG/M
Ga0181474_101094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → unclassified Corallococcus → Corallococcus sp. AB038B3079Open in IMG/M
Ga0181474_101514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli2125Open in IMG/M
Ga0181474_101713Not Available1853Open in IMG/M
Ga0181474_102544All Organisms → cellular organisms → Eukaryota1085Open in IMG/M
Ga0181474_103229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → unclassified Corallococcus → Corallococcus sp. AB038B790Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0181474_100325Ga0181474_1003256F078089MGLTEGKIIEQAYFILLKLEKNKEVLVSNDWGKIGKKT*
Ga0181474_100376Ga0181474_1003764F017428MENQQNIIPMGRLQGVAVDIEAASALVDFEVIEIFNDNNPYLVLLGIDWAIDMNKVINLKKRTMSFERKSLDVVVTPGPAEGSCYTKLVCDYESNDDLDQIYKIMM*
Ga0181474_100388Ga0181474_1003882F065416MSPTRSGYKELGLELVEPLQDKPHKSQRPPMEDENKDEGAGDLIKILLEEALE*
Ga0181474_100714Ga0181474_1007141F100750MEHIEDFQKLNIRVKDIPEEQNINVFIGILKDNIQHEVCLWEHDSFEKAFRLARKRERKISATRKLTTHNYKYGSGVSPTRLTPQQLK
Ga0181474_100892Ga0181474_1008923F028713VSDIIEDKKVLLVKVDSLKNNADALTKFVSFEKFSWCRETMGIAGLDK*
Ga0181474_101015Ga0181474_1010152F023843MENNGKIEIDKFNGKFFELWKLKMEYMLVNRDQWIIVDLGMPPTRMST*
Ga0181474_101094Ga0181474_1010942F017428MGRLQGVIVDIEGVSTQEDFEVIEIVNDSNPYPALLGIDWATIMNGVINMKKRKMIFEKKSPSVVVLLDLAKGVRHIELVHDDDSDDDLDCIYKITA*
Ga0181474_101398Ga0181474_1013985F096629MPRGKKMQTPSKEPEISSMTREKEEEMQHDISKLQDHVQQLSLTQKGT*
Ga0181474_101514Ga0181474_1015142F100750VEHLEDFQKLNIRVNDIPEEHRIDAFIRTLKDNIQHEVLLWEPNSLDKEFMVERKTERKIMETRKPTIRNYKYGIVFLLAFHNL*
Ga0181474_101713Ga0181474_1017132F034461MLGYDFEIIYKKGKQNVVADALSRKDEDVEALLCAISIIQPEWINKTWYEWKCWK*
Ga0181474_102108Ga0181474_1021082F021064TKKAILLKGLNCIPLLLLKSVKGIANKIKMAENIAITPNNLLGIDLNIA*
Ga0181474_102544Ga0181474_1025441F046363MVLDAMVFRSMVLDALACINMYCNIERKIMKNQAGSPGFGIQGKISVHMCFMGYALALFIFFV*
Ga0181474_103229Ga0181474_1032292F017428GASALEDFEVIEIVDDNNPYAALLGIDWATNMNGVINLKKHKMIFKKKYLCVVLPLDLVEGSNYTKPVRDYESDDNLDYIYKITA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.