


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013903 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118643 | Gp0137841 | Ga0117802 |
| Sample Name | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 244 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Chalmers University of Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 78210925 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067844 | Metagenome | 125 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0117802_1001755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3213 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0117802_1001755 | Ga0117802_10017551 | F067844 | MNTLAAETTSAWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAARIN |
| ⦗Top⦘ |