x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300013861
3300013861: Clean room spacecraft assembly facility microbial communities from NASA Jet Propulsion Laboratory, California, USA - Floor swab, replicate A SPAdes reassembly
Overview
Basic Information |
IMG/M Taxon OID | 3300013861 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095512 | Gp0056968 | Ga0181449 |
Sample Name | Clean room spacecraft assembly facility microbial communities from NASA Jet Propulsion Laboratory, California, USA - Floor swab, replicate A SPAdes reassembly |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 16988950 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa |
Type | Engineered |
Taxonomy | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) |
Location Information |
Location | NASA Jet Propulsion Laboratory, Pasadena, California, USA |
Coordinates | Lat. (o) | 34.1991 | Long. (o) | -118.1715 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F013050 | Metagenome / Metatranscriptome | 275 | Y |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0181449_105710 | Ga0181449_1057101 | F013050 | MSKGKQPRTRANKVPKLLLSEFKGVIILYNQGIGLEAAIF* |