NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013790

3300013790: Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - DC_AS_meta



Overview

Basic Information
IMG/M Taxon OID3300013790 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118583 | Gp0137230 | Ga0119888
Sample NameWastewater microbial communities from municipal sewage treatment plant in Nanjing, China - DC_AS_meta
Sequencing StatusPermanent Draft
Sequencing CenterNanjing University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size50769435
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China
TypeEngineered
TaxonomyEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationChina: Nanjing
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003544Metagenome / Metatranscriptome480Y
F005782Metagenome390Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0119888_1015296All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria528Open in IMG/M
Ga0119888_1016418All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria512Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0119888_1015296Ga0119888_10152961F005782RLGEIVKVMLARRRLATWGATGGPWDVKDISQTGFRLIAPMSAASAVTLNTLAAIRPYGHAFWTLGIVRRMRRLTSDRAEIGLQVIANTLIGVELCEQKRGSESPYSVEGENSTLDGRAFAGLFLALRKREGESAVQSLIVPAVEYQPAPRESSRHATSAPTRSALM*
Ga0119888_1016418Ga0119888_10164181F003544ALIAEAAEHQAQEIAGAATAYKAALVVLLFDRGISGKIAGQEIRSLRQSLPPTMPRMVSGRAVNLLAKPIPDVRTAVDFSSVMASIRDLGVLPATPVALVGVVPQEPQRA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.