NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013771

3300013771: Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M92206



Overview

Basic Information
IMG/M Taxon OID3300013771 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118585 | Gp0137246 | Ga0119904
Sample NameActivated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M92206
Sequencing StatusPermanent Draft
Sequencing CenterCalifornia Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size725554142
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. XJ19-131
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActivated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationAustralia: Brisbane, Thorneside Wastewater Treatment Plant
CoordinatesLat. (o)-27.485973Long. (o)153.190699Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009010Metagenome / Metatranscriptome324Y
F022055Metagenome / Metatranscriptome216Y
F054974Metagenome139Y
F088924Metagenome109Y
F090411Metagenome108Y
F091594Metagenome / Metatranscriptome107Y
F104545Metagenome / Metatranscriptome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0119904_10042475All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1531Open in IMG/M
Ga0119904_10174844Not Available755Open in IMG/M
Ga0119904_10210216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium685Open in IMG/M
Ga0119904_10218046All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. XJ19-13672Open in IMG/M
Ga0119904_10225535All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria660Open in IMG/M
Ga0119904_10255901Not Available617Open in IMG/M
Ga0119904_10353019All Organisms → cellular organisms → Bacteria519Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0119904_10005968Ga0119904_100059687F088924MKLHLLFAYLLLPVASLWADAQTTLLFAGSSSMYWNDLPREVAKLVDGKIAGHLGEPVIPEAVGRSGSDIRVYLEPGFNRYEYGVKPGQSFLDKIATEKPDIVPMMVVCRFIMGDDAPTNGNPDHATAITRYCEAIRAAGGEPMFYEMGWGKTEREAEGRQRILELAKKNKVTLFAPCSTAWARVYAEKPDLALQHPQDNAHPGDAGHFLNLACFYAALTRESPVGKLPRTYPVWPHGKYEADEAKLAAFQPDAYQAKMAKWMFKHMSMHATATLDDETACYLETVAWETWQAVSQTLLSGQK*
Ga0119904_10042475Ga0119904_100424752F090411MGRPKLPKGEAKGVLFAVRIAKAEADKVSQAIKRSGMKKPDWARNALLVAAGVVGNS*
Ga0119904_10174844Ga0119904_101748441F009010MNDVPELLYLFVNQPLLIAVPILAFVALALWSGSTTAWVTAGAGNLYLIYELGMKAGEFCDGTACLKRTPLYVAYPLLAILSLTALVQVYVHVRDRRRRQQLPATITGGLSP*
Ga0119904_10210216Ga0119904_102102162F054974MKEFSMNGLSQSRFWVGIVLIVIAVLIVLLAPAGYSTAGAIAIGVLGLVSIAISRRQPTAS*
Ga0119904_10218046Ga0119904_102180461F091594MSEQAIKTFCLGNGEIGCDGCEQEKNWQTLNQMPNALRLAMQDTARRIDDTECILRGRLWRQY*
Ga0119904_10225535Ga0119904_102255352F104545VRVGKDQPIRTCTAQHARRRIVGQQAGIDCDAATRAVRVSMVSGQPDVEPVDTILRSGGRRKTFRDALASRGRVRQRLEMAPVANPFRHAVIKVAAQAPDRERSRSGSSPRWQLGP*
Ga0119904_10255901Ga0119904_102559012F054974MMTSRQLAWSRLIVGLVLVLIAALMFLLPDATYSTAGAVAIGILGLISIAISRR*
Ga0119904_10353019Ga0119904_103530191F022055RKATRLWVQRDGRAPCLPGGSLLDKPIGDKIFSREAIGFFAGAPLPWSKVWLTAIAIALLKHARATEGLKVNARLAGLLRDAQLHGVIDHFVRLLDLTPSELQRAATDTDGHLVPRLRALKTPVAIFIDGIDEYFNKHVEERPTNPSVTGELSPQVWYFAQLGLVEVAYQLR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.