NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013762

3300013762: Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-J598



Overview

Basic Information
IMG/M Taxon OID3300013762 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118446 | Gp0134499 | Ga0116693
Sample NameBeach sand microbial communities from Municipal Pensacola Beach, Florida - OS-J598
Sequencing StatusPermanent Draft
Sequencing CenterGeorgia Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size226239734
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBeach Sand Microbial Communities From Municipal Pensacola Beach, Florida
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand → Beach Sand Microbial Communities From Municipal Pensacola Beach, Florida

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomebeachbeach sand
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Municipal Pensacola Beach, FL
CoordinatesLat. (o)30.3262Long. (o)-87.1745Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001186Metagenome / Metatranscriptome754Y
F001506Metagenome / Metatranscriptome681Y
F010714Metagenome / Metatranscriptome300Y
F046726Metagenome / Metatranscriptome151Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0116693_1000053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4735Open in IMG/M
Ga0116693_1019796Not Available657Open in IMG/M
Ga0116693_1031803Not Available584Open in IMG/M
Ga0116693_1041694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0116693_1000053Ga0116693_10000533F001506MNRILYENRCRCNEEFSITKKRKSPTRSEGKPLQYPKSDEIISKTFQIKYPNKLSLTAKFILNSFQNKYIYYAIDDILDTRTERENLLAILYSPLLSLQNNFSVNFFDIWIREVYIEEVAKTNRFLSKNSQTLDQFSYITIQFFYKTKVPVRKQESLW*
Ga0116693_1019796Ga0116693_10197962F046726LGRISEQEKIEIIQRGFQLQAEGKISLKKYYESTDPNSLVQSKGYSIKYESIRRTKLYQQLKPSNN*
Ga0116693_1031803Ga0116693_10318032F010714MRVKLQLVISHDDGHEETITDVITLNKNHKRIEHLGLSLAESKQLLSTVSPGSSGR*
Ga0116693_1041694Ga0116693_10416941F001186MTQQDSWTTRLKNYIADVLPWTHGHQLKGITTFVGAILEKQTGNQAELARGQGNQEAAVKRLSRLLHNARLGPHRLADSVLAQALEQLPAKGTVRLAIDWTIEAPHHLLVVSLLTGGRAVPIYWRADDAGGVEGGLRRSEEGGMTAVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.