Basic Information | |
---|---|
IMG/M Taxon OID | 3300013755 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118614 | Gp0137486 | Ga0117777 |
Sample Name | Crude oil microbial communities from oil reservoirs in Daqing, China - Crude oil from DQ |
Sequencing Status | Permanent Draft |
Sequencing Center | Peking University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 186329732 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Crude Oil Microbial Communities From Oil Reservoirs In China |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Crude Oil → Crude Oil Microbial Communities From Oil Reservoirs In China |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → oil reservoir → oil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Daqing | |||||||
Coordinates | Lat. (o) | 45.5 | Long. (o) | 124.15 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015605 | Metagenome / Metatranscriptome | 253 | N |
F071210 | Metagenome / Metatranscriptome | 122 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0117777_1028446 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
Ga0117777_1067137 | Not Available | 697 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0117777_1028446 | Ga0117777_10284462 | F071210 | MKEKRWLGTQKYELHCFYCGGFHMTGNCPQIVKEMNGWKYDRSCPETGHIKIVPNGDEYPTVLAFNGYHYRVVGLWGVPGKLLWLELQRFCGDTIVAATFCPDELMEMDLGMSDDEQLSAWLGGLPFLSVSPPEFNGSEAEADVKTTTGESL* |
Ga0117777_1067137 | Ga0117777_10671371 | F015605 | MYNNAVLLQTLQQVRFKVIDTLKLMLSDYEVSPESSVRVQPASYEVATGEKVEFPLFRNEAGTFYGSKAYLNTENWNLTLKPLPAGNRGVGAFLQFSVPKNYYGSNYFSVGEAGTRAALKKVENELVQNGVFTNLEEAELSRVDTFKNIEP |
⦗Top⦘ |