NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013755

3300013755: Crude oil microbial communities from oil reservoirs in Daqing, China - Crude oil from DQ



Overview

Basic Information
IMG/M Taxon OID3300013755 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118614 | Gp0137486 | Ga0117777
Sample NameCrude oil microbial communities from oil reservoirs in Daqing, China - Crude oil from DQ
Sequencing StatusPermanent Draft
Sequencing CenterPeking University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size186329732
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCrude Oil Microbial Communities From Oil Reservoirs In China
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Crude Oil → Crude Oil Microbial Communities From Oil Reservoirs In China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeoil reservoiroil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationChina: Daqing
CoordinatesLat. (o)45.5Long. (o)124.15Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015605Metagenome / Metatranscriptome253N
F071210Metagenome / Metatranscriptome122N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0117777_1028446All Organisms → cellular organisms → Bacteria1163Open in IMG/M
Ga0117777_1067137Not Available697Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0117777_1028446Ga0117777_10284462F071210MKEKRWLGTQKYELHCFYCGGFHMTGNCPQIVKEMNGWKYDRSCPETGHIKIVPNGDEYPTVLAFNGYHYRVVGLWGVPGKLLWLELQRFCGDTIVAATFCPDELMEMDLGMSDDEQLSAWLGGLPFLSVSPPEFNGSEAEADVKTTTGESL*
Ga0117777_1067137Ga0117777_10671371F015605MYNNAVLLQTLQQVRFKVIDTLKLMLSDYEVSPESSVRVQPASYEVATGEKVEFPLFRNEAGTFYGSKAYLNTENWNLTLKPLPAGNRGVGAFLQFSVPKNYYGSNYFSVGEAGTRAALKKVENELVQNGVFTNLEEAELSRVDTFKNIEP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.