x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300013413
3300013413: Regolith bacterial community from Guaba Ridge, Luquillo Mountain, Puerto Rico enriched on smectite - SM5
Overview
| Basic Information |
| IMG/M Taxon OID | 3300013413 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128736 | Gp0206493 | Ga0177918 |
| Sample Name | Regolith bacterial community from Guaba Ridge, Luquillo Mountain, Puerto Rico enriched on smectite - SM5 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Wisconsin, Madison |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 72877730 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Regolith Bacterial Community From Guaba Ridge, Luquillo Mountains, Puerto Rico |
| Type | Engineered |
| Taxonomy | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Regolith → Regolith Bacterial Community From Guaba Ridge, Luquillo Mountains, Puerto Rico |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information |
| Location | Guaba Ridge, Luquillo Mountain, Puerto Rico |
| Coordinates | Lat. (o) | 18.28 | Long. (o) | -65.79 | Alt. (m) | N/A | Depth (m) | 7.8 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F019528 | Metagenome / Metatranscriptome | 229 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0177918_114129 | Ga0177918_1141291 | F019528 | VTYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP* |
