NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013413

3300013413: Regolith bacterial community from Guaba Ridge, Luquillo Mountain, Puerto Rico enriched on smectite - SM5



Overview

Basic Information
IMG/M Taxon OID3300013413 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128736 | Gp0206493 | Ga0177918
Sample NameRegolith bacterial community from Guaba Ridge, Luquillo Mountain, Puerto Rico enriched on smectite - SM5
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Wisconsin, Madison
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size72877730
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameRegolith Bacterial Community From Guaba Ridge, Luquillo Mountains, Puerto Rico
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Regolith → Regolith Bacterial Community From Guaba Ridge, Luquillo Mountains, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationGuaba Ridge, Luquillo Mountain, Puerto Rico
CoordinatesLat. (o)18.28Long. (o)-65.79Alt. (m)N/ADepth (m)7.8
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019528Metagenome / Metatranscriptome229Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0177918_114129All Organisms → cellular organisms → Bacteria607Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0177918_114129Ga0177918_1141291F019528VTYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.