| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013333 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118585 | Gp0137252 | Ga0119910 |
| Sample Name | Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90106 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | California Institute of Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 8607499 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Australia: Queensland | |||||||
| Coordinates | Lat. (o) | -27.49999 | Long. (o) | 153.01209 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013948 | Metagenome / Metatranscriptome | 267 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0119910_102202 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0119910_102202 | Ga0119910_1022022 | F013948 | MREKLKKIVAYIFRSWEDEPGHTHPRLKILPPFLLELLAYLIGLAILY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |