Sample 3300013292

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013292

3300013292: Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-08

Overview

Basic Information
IMG/M Taxon OID	3300013292 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118444 \| Gp0134403 \| Ga0120683
Sample Name	Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-08
Sequencing Status	Permanent Draft
Sequencing Center	Weill Cornell Medical College
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	80570099
Sequencing Scaffolds	1
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
Type	Engineered
Taxonomy	Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	USA:New York City
Coordinates	Lat. (^o)	40.67	Long. (^o)	-73.98	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058437	Metagenome / Metatranscriptome	135	Y
F058743	Metagenome / Metatranscriptome	134	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0120683_1003348	Not Available	845	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120683_1003348	Ga0120683_10033482	F058437	LFADSGAADVAVREEAHAMMRALNQIEMKLDAAITAETFLDRKQRK*
Ga0120683_1016703	Ga0120683_10167031	F058743	KMSFIWSCFAYMGTERQIKTVKSWAYKTNIDTEEDRDNYWHQHLREGSLSLSGVYYLHLPEGVNLETSGTEFSHTTPEDVDNRFFAPAKVGHWVIWPGKAWHRPGILESKDWRYIVAADMEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.