NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013290

3300013290: Enriched microbial communities from a natural gas condensate-contaminated anoxic aquifer near Ft. Lupton, CO, USA ? 13C-labelled, 2 mo incubation



Overview

Basic Information
IMG/M Taxon OID3300013290 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127588 | Gp0198185 | Ga0172517
Sample NameEnriched microbial communities from a natural gas condensate-contaminated anoxic aquifer near Ft. Lupton, CO, USA ? 13C-labelled, 2 mo incubation
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Calgary
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size68705674
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameStable Isotope And Metagenomic Profiling Of A Methanogenic Naphthalene-Degrading Enrichment Culture
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Anoxic Aquifer → Stable Isotope And Metagenomic Profiling Of A Methanogenic Naphthalene-Degrading Enrichment Culture

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeaquiferrock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationSouth Platte Alluvial Aquifer near Denver, CO, USA
CoordinatesLat. (o)40.3921Long. (o)-104.7158Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059711Metagenome133Y
F091072Metagenome / Metatranscriptome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0172517_100544All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix13479Open in IMG/M
Ga0172517_104269Not Available1739Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0172517_100544Ga0172517_1005448F091072MAGTMKEAVAPVREETEEEIRTLLEGAQAAWAQYKQGQGVRITSTKELDAFLDSL*
Ga0172517_104269Ga0172517_1042691F059711MRTRTLHTPINLLIEPNTYQRLKMIAGLQKTTMSKFIREGIKLRLAQYD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.