| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013284 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118444 | Gp0134404 | Ga0120684 |
| Sample Name | Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-09 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Weill Cornell Medical College |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 79242335 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lightbulbvirus | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA:New York City | |||||||
| Coordinates | Lat. (o) | 40.67 | Long. (o) | -73.99 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053659 | Metagenome / Metatranscriptome | 141 | Y |
| F059010 | Metagenome / Metatranscriptome | 134 | N |
| F062246 | Metagenome | 131 | Y |
| F086602 | Metagenome / Metatranscriptome | 110 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120684_1001424 | Not Available | 924 | Open in IMG/M |
| Ga0120684_1009426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lightbulbvirus | 597 | Open in IMG/M |
| Ga0120684_1010397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 584 | Open in IMG/M |
| Ga0120684_1013031 | Not Available | 553 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120684_1001424 | Ga0120684_10014241 | F086602 | FDKGGYSGLIFLALSKESGVRFYVPAMRYASNVTQWEQLQEDDFDATLFTFDKHADWPVDRRPVYRLADTEMTLNVREGGKVVDTVTLRAVVLHDPQGEKPAERWPVVILTDDREIDAQALLNEYGDHWGQETAHRIGKHDLYLDILPPGYVLKTQRDDQGELQREVTFDQTAFFLSGWLRCLVFNLMTRFAEAMGGEYTKMWAGTLLRKFIRRPATLYLVDKELHVVFDPFPGHDELQLLLDKLNAKRTVLPWLNNLVVQFSIAQDEPVHPLTEPEKRNRLFGDG* |
| Ga0120684_1009426 | Ga0120684_10094262 | F059010 | MTRLELLNQVAEKLERSEYTPIVTEKEEMQIWAMLLNEVYEET |
| Ga0120684_1010397 | Ga0120684_10103971 | F053659 | HSIRRRAPMNSVNETKQKRQNRTVTLYLGNTLAEYQEMISTEEGMQTLIQQVEIADSLNWGHLADGHHEGCPRCLRFTHHDDYARWTKHFDGTQELVTIIRARCLDCEAVFTIQPSFIVRYKRYDTDAMEKFMVLLFITEDSYRMAGVSQALGMDTHQEGTWVALEKAVMFNLNI* |
| Ga0120684_1013031 | Ga0120684_10130311 | F062246 | MDFSMERKLREINGSYIITIPKQVCDLYGFKPNDTFSIEPIGNNELRLRK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |