Basic Information | |
---|---|
IMG/M Taxon OID | 3300013282 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118585 | Gp0137270 | Ga0119927 |
Sample Name | Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V92809 |
Sequencing Status | Permanent Draft |
Sequencing Center | California Institute of Technology |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 45829823 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 1 |
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
Type | Engineered |
Taxonomy | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Australia: Queensland | |||||||
Coordinates | Lat. (o) | -27.49999 | Long. (o) | 153.01209 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F095570 | Metagenome / Metatranscriptome | 105 | Y |
F100051 | Metagenome / Metatranscriptome | 103 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0119927_108576 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
Ga0119927_110157 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 733 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0119927_108576 | Ga0119927_1085763 | F100051 | VFGHRYVVERVLNHGARKVGCTRCGKHWGMHDVTRSFVPWDGELEALYAPGGILAQASGDVPPNAKVSGAGTASAGLPG* |
Ga0119927_110157 | Ga0119927_1101571 | F095570 | PQNPKTPFQFNIIIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA* |
⦗Top⦘ |