NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013280

3300013280: Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90903



Overview

Basic Information
IMG/M Taxon OID3300013280 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118585 | Gp0137257 | Ga0119915
Sample NameActivated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90903
Sequencing StatusPermanent Draft
Sequencing CenterCalifornia Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size33646596
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActivated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationAustralia: Queensland
CoordinatesLat. (o)-27.49999Long. (o)153.01209Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043249Metagenome / Metatranscriptome156Y
F078533Metagenome / Metatranscriptome116Y
F082719Metagenome / Metatranscriptome113Y
F091594Metagenome / Metatranscriptome107Y
F100051Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0119915_101265All Organisms → cellular organisms → Bacteria2152Open in IMG/M
Ga0119915_101481Not Available1934Open in IMG/M
Ga0119915_101807Not Available1676Open in IMG/M
Ga0119915_103652All Organisms → cellular organisms → Bacteria1055Open in IMG/M
Ga0119915_103964All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1004Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0119915_101265Ga0119915_1012652F100051MLERLICAVFGHRYVVERVLNHGARKVGCTRCGKHWAMHDGTRSFVPWDGEFEALYAPGGILAEASEDGTPNAKVKGAE*
Ga0119915_101481Ga0119915_1014812F082719MDRPSVFYNTKMEAMMASRDEEFVTEAREANRKIWDGINALIALQRQWNALDYGNTLAVDGVVAAEVGAVVFDTATAFVAVLNAGHATNMAKLL*
Ga0119915_101807Ga0119915_1018075F078533MTPAEFKRARETLCLSQNDLAEVWGMGDNGGRTIRRGERGGRPLTPTPRG
Ga0119915_103652Ga0119915_1036522F091594DQERRDRGKNQMNDNGITTYCLGSGELKCDGCGQEKNWQALNQMPDALRKALQAQARRIDDTECILSGRPWYVAA*
Ga0119915_103964Ga0119915_1039642F043249MPKIVGTRERVHQPFYDSLIRVDGATDLRGATVGAFGAVQARSQLFVRQGADLAVSNLTTGGFFPSDQTFITLAVRVWTYFRFNGEQQFVSGQGTFPVDSVAGLTSDRVMRVHKLYHQSQNQLFWQLVAGDKPQLTTFTAYTPFAGGLDGFFADSRLPRANNGVPTSSALMRLARPVLIPPRQGFQVVAIASPIGQSVGAPLIEEPTG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.