x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300013135
3300013135: Petroleum sludge microbial communities from waste storage tank in Noonmati IOCL oil refinery, Guwahati, Assam, India - point GR3 51
Overview
| Basic Information |
| IMG/M Taxon OID | 3300013135 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0127555 | Gp0197238 | Ga0171660 |
| Sample Name | Petroleum sludge microbial communities from waste storage tank in Noonmati IOCL oil refinery, Guwahati, Assam, India - point GR3 51 |
| Sequencing Status | Finished |
| Sequencing Center | Life Technologies |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 253343795 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Petroleum Sludge Microbial Communities From Waste Storage Tank In Noonmati Iocl Oil Refinery, Guwahati, Assam, India |
| Type | Engineered |
| Taxonomy | Engineered → Built Environment → Oil Refinery → Petroleum Sludge → Unclassified → Petroleum Sludge → Petroleum Sludge Microbial Communities From Waste Storage Tank In Noonmati Iocl Oil Refinery, Guwahati, Assam, India |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information |
| Location | Guwahati, Assam, India |
| Coordinates | Lat. (o) | 26.18471 | Long. (o) | 91.80725 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F021262 | Metagenome / Metatranscriptome | 219 | N |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0171660_10380280 | Ga0171660_103802801 | F021262 | MSKKYYIKFTTGKELTGTAKEIVTQLRNESRLLAITPRKYARLVAKSYEMSTGLKLRTWTYNSFVKSL |
