NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013073

3300013073: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft OP (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300013073 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127392 | Gp0191766 | Ga0164283
Sample NameEnriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft OP (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size66962496
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
Not Available1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → anthropogenic environment → compost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008634Metagenome / Metatranscriptome330Y
F012606Metagenome / Metatranscriptome279Y
F017885Metagenome / Metatranscriptome238Y
F034415Metagenome / Metatranscriptome175Y
F052044Metagenome / Metatranscriptome143N
F064047Metagenome / Metatranscriptome129Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0164283_1007092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3413Open in IMG/M
Ga0164283_1018415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1896Open in IMG/M
Ga0164283_1019996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1603Open in IMG/M
Ga0164283_1027328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2073Open in IMG/M
Ga0164283_1061218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
Ga0164283_1073706Not Available751Open in IMG/M
Ga0164283_1097349All Organisms → cellular organisms → Bacteria2254Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0164283_1007092Ga0164283_10070922F052044MADADRLEKIATIGQDLITTQLTMATQTPSQALEGTWVLGYCFGIFDALAQQADLDDGAEVFGLVTLGFLGLFADPADPEAAAFIRRSLDRQDNPRFQEGAAAGGTDVFVWVADRIKAPNALFEHLSR*
Ga0164283_1018415Ga0164283_10184152F012606MAISAGRDVTILLSDEHLRKIAEDHLLAGKDLEDRVKLARVVQKLVDASLGLPDRPWHEWDEWVKGLE*
Ga0164283_1019996Ga0164283_10199964F034415MSAAATHTGHKRLQHLVEHEAYRRIMAGEAPETLSEFARELQGWLQRTHPDAAPTTPDAIENQIRETWHRRHELIRGG*
Ga0164283_1027328Ga0164283_10273283F017885MANPNADVAGFQCPKCGQELEQTIGQLKSSEHMICSGCGIGINIDTNRLADVADELQKATAKVQSEITIKFYR*
Ga0164283_1061218Ga0164283_10612182F008634SPSHRADFHSDVEDGMYGHGRELEVGNATSAILVSLLRTLIEKSVLSNGDVRTLLTDAAATLAPHEYTAPFQGAIGIILEDILPKFPENGGD*
Ga0164283_1073706Ga0164283_10737061F064047MTLKKVSRAGLLALALGVLLGLFLSVASFDAASAQTP
Ga0164283_1097349Ga0164283_10973494F034415MTGAPGHKKSQHLIEAEAYRRIIAGEAPETLGAFAQQLLDWLQTAYPGAVPGSLATVEEQIRETWDRRHDLIRGG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.