Sample 3300013056

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013056

3300013056: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C BE-Lig OP (Metagenome Metatranscriptome)

Overview

Basic Information
IMG/M Taxon OID	3300013056 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0127392 \| Gp0191751 \| Ga0164270
Sample Name	Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C BE-Lig OP (Metagenome Metatranscriptome)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	32781239
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → anthropogenic environment → compost
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	USA: Emeryville, California
Coordinates	Lat. (^o)	37.83	Long. (^o)	-122.29	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039520	Metagenome / Metatranscriptome	163	Y
F072045	Metagenome / Metatranscriptome	121	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0164270_131162	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	738	Open in IMG/M
Ga0164270_136982	Not Available	675	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0164270_131162	Ga0164270_1311622	F039520	LVLNISRGKSSQSGGAPVTDLQRLDLTVFAEIRPNVLKILQHLCSASCHTFGGVLEWCEARGDCAQAVVCPVCSTQFVVDDDELEELLRWTDGEGKALVCGVRWD*
Ga0164270_136982	Ga0164270_1369821	F072045	LWSDLIDQSISLKEEISVPVLHVRKPNEAPPPSRSSRAVREQQQKYDEFVRKIDANDVGDLELEPNENLRSVKVRLRRASSRLGVDIDIWDANGHVYFQRVTRRGRRRQA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.