NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013056

3300013056: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C BE-Lig OP (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300013056 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127392 | Gp0191751 | Ga0164270
Sample NameEnriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C BE-Lig OP (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size32781239
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeanthropogenic environmentcompost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039520Metagenome / Metatranscriptome163Y
F072045Metagenome / Metatranscriptome121Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0164270_131162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium738Open in IMG/M
Ga0164270_136982Not Available675Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0164270_131162Ga0164270_1311622F039520LVLNISRGKSSQSGGAPVTDLQRLDLTVFAEIRPNVLKILQHLCSASCHTFGGVLEWCEARGDCAQAVVCPVCSTQFVVDDDELEELLRWTDGEGKALVCGVRWD*
Ga0164270_136982Ga0164270_1369821F072045LWSDLIDQSISLKEEISVPVLHVRKPNEAPPPSRSSRAVREQQQKYDEFVRKIDANDVGDLELEPNENLRSVKVRLRRASSRLGVDIDIWDANGHVYFQRVTRRGRRRQA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.