Sample 3300013015

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013015

3300013015: Subsurface microbial communities from deep shales in West Virginia, USA - MSEEL Well Study Marcellus 3H_2016_09_14

Overview

Basic Information
IMG/M Taxon OID	3300013015 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118431 \| Gp0191407 \| Ga0163222
Sample Name	Subsurface microbial communities from deep shales in West Virginia, USA - MSEEL Well Study Marcellus 3H_2016_09_14
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	16240183
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → planetary subsurface zone → oil field production water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	USA: West Virginia
Coordinates	Lat. (^o)	39.6017	Long. (^o)	-79.9761	Alt. (m)	N/A	Depth (m)	2281
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087432	Metagenome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0163222_100094	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	7485	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0163222_100094	Ga0163222_1000946	F087432	MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLNFEQITFSAEQDARLQEISELSIPQGFQAQVREYVENGNFPEGYEHPLSDLKLKKERLQHQNDIDEAYQTILESEGLI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.