Basic Information | |
---|---|
IMG/M Taxon OID | 3300013015 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118431 | Gp0191407 | Ga0163222 |
Sample Name | Subsurface microbial communities from deep shales in West Virginia, USA - MSEEL Well Study Marcellus 3H_2016_09_14 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 16240183 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → planetary subsurface zone → oil field production water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: West Virginia | |||||||
Coordinates | Lat. (o) | 39.6017 | Long. (o) | -79.9761 | Alt. (m) | N/A | Depth (m) | 2281 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087432 | Metagenome | 110 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0163222_100094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 7485 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0163222_100094 | Ga0163222_1000946 | F087432 | MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLNFEQITFSAEQDARLQEISELSIPQGFQAQVREYVENGNFPEGYEHPLSDLKLKKERLQHQNDIDEAYQTILESEGLI* |
⦗Top⦘ |