Basic Information | |
---|---|
IMG/M Taxon OID | 3300012879 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121620 | Gp0191462 | Ga0160504 |
Sample Name | Enriched soil microbial communities from UW Madison campus, WI, USA - DID2937_E24_Xylan MG |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 226810859 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota | 2 |
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → prairie → soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Madison, Wisconsin | |||||||
Coordinates | Lat. (o) | 43.073 | Long. (o) | -89.4011 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005470 | Metagenome / Metatranscriptome | 399 | Y |
F018299 | Metagenome / Metatranscriptome | 235 | Y |
F096377 | Metagenome / Metatranscriptome | 104 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0160504_1003187 | All Organisms → cellular organisms → Eukaryota | 4876 | Open in IMG/M |
Ga0160504_1008222 | All Organisms → cellular organisms → Eukaryota | 2881 | Open in IMG/M |
Ga0160504_1009543 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 2660 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0160504_1003187 | Ga0160504_10031874 | F018299 | MVGDDLNVGTILSEQAFFLKSGVFSLVKLGETPLAGDDDLLSTGELEFTSSESFNSMGNVLFVKSDGVEDLVNLNSGDFTNGLTEGTSHTSLESIGTSAGKHLVNSEDVPRVNSASKMETFLTALLDQVLVGSNTSSFHGFGGDLFLFERNEVNTEGEFFDFSLLFTGIINSDSGIGDTSVITRLGERLATPVSVASSGSSSHFMTLFSLISIKLY* |
Ga0160504_1008222 | Ga0160504_10082221 | F005470 | MSVKLRKEGQVITEFPSDMVPRSRLLTKLVEEFISTEVDLEPAPGKDFSPSTINKVKEFLDKFNKGLNKMPKKPLLIFVTYNDWLDNNFDESTREWLEEFLKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGVVTQYQDFFTPEEEAKFIEKEFINKNDFEGVAAEDDEELNKE* |
Ga0160504_1009543 | Ga0160504_10095431 | F096377 | RWKSFNVTHHKVAGKDRKYIKINNNGDLVQFQSKYKSTPLYFIPTDDNNVNVFITDNGNKTFLIEDFLIQIVDAIISDILGQEDIIEDVVSKLFAKLERNPTPFQEDLWLPIFSIKEKAIDLEAAKSLLKDEYKVNYATNTCTIGLNGSRVPGNLKVRPSEKSKILEKPFLFGKFSFIKIFFSNIS* |
⦗Top⦘ |